SCOPe 2.06: Domain d2ehza1: 2ehz A:4-137

Lineage for d2ehza1 (2ehz A:4-137)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (20 species)
   not a true protein

7. Species Pseudomonas sp. [TaxId:69011] [230718] (5 PDB entries)

8. Domain d2ehza1: 2ehz A:4-137 [241759]
   automated match to d2ei0a1
   complexed with edo, fe2, mct, mg

Details for d2ehza1

PDB Entry: 2ehz, 1.35 Å

PDB Description: Anaerobic Crystal Structure Analysis of 1,2-dihydroxynaphthalene dioxygenase from Pseudomonas sp. strain C18 complexed with 4-methylcatechol

PDB Compounds: (A:) 1,2-dihydroxynaphthalene dioxygenase

SCOPe Domain Sequences for d2ehza1:

Sequence; same for both SEQRES and ATOM records:

>d2ehza1 d.32.1.0 (A:4-137) automated matches {Pseudomonas sp. [TaxId: 69011]}
qaavielgymgisvkdpdawksfatdmlglqvldegekdrfylrmdywhhrivvhhngqd
dleylgwrvagkpefealgqklidagykiricdkveaqermvlglmktedpggnpteifw
gpridmsnpfhpgr

Timeline for d2ehza1:

• d2ehza1 first appeared in SCOPe 2.04
  
• d2ehza1 appears in SCOPe 2.05
  
• d2ehza1 appears in SCOPe 2.07
  
• d2ehza1 appears in the current release, SCOPe 2.08