SCOPe 2.05: Domain d2edxa_: 2edx A:

Lineage for d2edxa_ (2edx A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (36 PDB entries)

8. Domain d2edxa_: 2edx A: [241736]
   automated match to d4n5ua_

Details for d2edxa_

PDB Entry: 2edx

PDB Description: solution structures of the fn3 domain of human receptor-type tyrosine- protein phosphatase f

PDB Compounds: (A:) Protein tyrosine phosphatase, receptor type, F

SCOPe Domain Sequences for d2edxa_:

Sequence; same for both SEQRES and ATOM records:

>d2edxa_ b.1.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgtieartaqstpsappqkvmcvsmgsttvrvswvpppadsrngvitqysvayea
vdgedrgrhvvdgisrehsswdlvglekwteyrvwvrahtdvgpgpesspvlvrtdedvp
sgpprkvesgpssg

Timeline for d2edxa_:

• d2edxa_ first appeared in SCOPe 2.04
  
• d2edxa_ is called d2edxa1 in SCOPe 2.06
  
• d2edxa_ appears in the current release, SCOPe 2.08, called d2edxa1