SCOPe 2.06: Domain d2edia1: 2edi A:8-167

Lineage for d2edia1 (2edi A:8-167)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.0: automated matches [191322] (1 protein)
   not a true family

6. Protein automated matches [190120] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186843] (19 PDB entries)

8. Domain d2edia1: 2edi A:8-167 [241730]
   Other proteins in same PDB: d2edia2, d2edia3
   automated match to d3fn1b_

Details for d2edia1

PDB Entry: 2edi

PDB Description: solution structure of the uq_con domain from human nedd8-conjugating enzyme nce2

PDB Compounds: (A:) NEDD8-conjugating enzyme UBE2F

SCOPe Domain Sequences for d2edia1:

Sequence; same for both SEQRES and ATOM records:

>d2edia1 d.20.1.0 (A:8-167) automated matches {Human (Homo sapiens) [TaxId: 9606]}
strrvsvrdkllvkevaeleanlpctckvhfpdpnklhcfqltvtpdegyyqggkfqfet
evpdaynmvppkvkcltkiwhpnitetgeiclsllrehsidgtgwaptrtlkdvvwglns
lftdllnfddplnieaaehhlrdkedfrnkvddyikryar

Timeline for d2edia1:

• d2edia1 first appeared in SCOPe 2.04, called d2edia_
  
• d2edia1 was called d2edia_ in SCOPe 2.05
  
• d2edia1 appears in SCOPe 2.07
  
• d2edia1 appears in the current release, SCOPe 2.08