SCOPe 2.04: Domain d2edda_: 2edd A:

Lineage for d2edda_ (2edd A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (27 PDB entries)

8. Domain d2edda_: 2edd A: [241727]
   automated match to d1wfua_

Details for d2edda_

PDB Entry: 2edd

PDB Description: solution structure of the fifth fibronectin type iii domain of human netrin receptor dcc

PDB Compounds: (A:) Netrin receptor DCC

SCOPe Domain Sequences for d2edda_:

Sequence; same for both SEQRES and ATOM records:

>d2edda_ b.1.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgfptsvpdlstpmlppvgvqavalthdavrvswadnsvpknqktsevrlytvrw
rtsfsasakyksedttslsytatglkpntmyefsvmvtknrrsstwsmtahattyeasgp
ssg

Timeline for d2edda_:

• d2edda_ is new in SCOPe 2.04-stable
  
• d2edda_ appears in SCOPe 2.05
  
• d2edda_ appears in the current release, SCOPe 2.08, called d2edda1