SCOPe 2.08: Domain d2edda1: 2edd A:8-117

Lineage for d2edda1 (2edd A:8-117)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries)

8. Domain d2edda1: 2edd A:8-117 [241727]
   Other proteins in same PDB: d2edda2, d2edda3
   automated match to d1wfua_

Details for d2edda1

PDB Entry: 2edd

PDB Description: solution structure of the fifth fibronectin type iii domain of human netrin receptor dcc

PDB Compounds: (A:) Netrin receptor DCC

SCOPe Domain Sequences for d2edda1:

Sequence; same for both SEQRES and ATOM records:

>d2edda1 b.1.2.0 (A:8-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fptsvpdlstpmlppvgvqavalthdavrvswadnsvpknqktsevrlytvrwrtsfsas
akyksedttslsytatglkpntmyefsvmvtknrrsstwsmtahattyea

Timeline for d2edda1:

• d2edda1 first appeared in SCOPe 2.04, called d2edda_
  
• d2edda1 appears in SCOPe 2.07