SCOPe 2.06: Domain d2ed9a1: 2ed9 A:8-124

Lineage for d2ed9a1 (2ed9 A:8-124)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (54 PDB entries)

8. Domain d2ed9a1: 2ed9 A:8-124 [241726]
   Other proteins in same PDB: d2ed9a2
   automated match to d1x5ha1

Details for d2ed9a1

PDB Entry: 2ed9

PDB Description: solution structure of the third fibronectin type iii domain of human netrin receptor dcc

PDB Compounds: (A:) Netrin receptor DCC

SCOPe Domain Sequences for d2ed9a1:

Sequence; same for both SEQRES and ATOM records:

>d2ed9a1 b.1.2.0 (A:8-124) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nrygpgvstdditvvtlsdvpsappqnvslevvnsrsikvswlpppsgtqngfitgykir
hrkttrrgemetlepnnlwylftglekgsqysfqvsamtvngtgppsnwytaetpen

Timeline for d2ed9a1:

• d2ed9a1 first appeared in SCOPe 2.04, called d2ed9a_
  
• d2ed9a1 was called d2ed9a_ in SCOPe 2.05
  
• d2ed9a1 appears in SCOPe 2.07
  
• d2ed9a1 appears in the current release, SCOPe 2.08