SCOPe 2.08: Domain d2ecda1: 2ecd A:8-113

Lineage for d2ecda1 (2ecd A:8-113)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.0: automated matches [191409] (1 protein)
   not a true family

6. Protein automated matches [190561] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187549] (77 PDB entries)

8. Domain d2ecda1: 2ecd A:8-113 [241720]
   Other proteins in same PDB: d2ecda2, d2ecda3
   automated match to d1csza_

Details for d2ecda1

PDB Entry: 2ecd

PDB Description: solution structure of the human abl2 sh2 domain

PDB Compounds: (A:) Tyrosine-protein kinase ABL2

SCOPe Domain Sequences for d2ecda1:

Sequence; same for both SEQRES and ATOM records:

>d2ecda1 d.93.1.0 (A:8-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tpvnslekhswyhgpvsrsaaeyllsslingsflvresesspgqlsislryegrvyhyri
nttadgkvyvtaesrfstlaelvhhhstvadglvttlhypapkcnk

Timeline for d2ecda1:

• d2ecda1 first appeared in SCOPe 2.04, called d2ecda_
  
• d2ecda1 appears in SCOPe 2.07