SCOPe 2.08: Domain d2e6sa1: 2e6s A:8-77

Lineage for d2e6sa1 (2e6s A:8-77)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families)

5. Family g.50.1.0: automated matches [191482] (1 protein)
   not a true family

6. Protein automated matches [190772] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187998] (28 PDB entries)

8. Domain d2e6sa1: 2e6s A:8-77 [241696]
   Other proteins in same PDB: d2e6sa2
   automated match to d3soub_
   complexed with zn

Details for d2e6sa1

PDB Entry: 2e6s

PDB Description: solution structure of the phd domain in ring finger protein 107

PDB Compounds: (A:) E3 ubiquitin-protein ligase UHRF2

SCOPe Domain Sequences for d2e6sa1:

Sequence; same for both SEQRES and ATOM records:

>d2e6sa1 g.50.1.0 (A:8-77) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rndtecdlcggdpekkchscscrvcggkhepnmqllcdecnvayhiyclnppldkvpeee
ywycpscktd

Timeline for d2e6sa1:

• d2e6sa1 first appeared in SCOPe 2.04, called d2e6sa_
  
• d2e6sa1 appears in SCOPe 2.07