SCOPe 2.06: Domain d2e5ha1: 2e5h A:1-87

Lineage for d2e5ha1 (2e5h A:1-87)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188315] (87 PDB entries)

8. Domain d2e5ha1: 2e5h A:1-87 [241687]
   Other proteins in same PDB: d2e5ha2
   automated match to d1x5sa1

Details for d2e5ha1

PDB Entry: 2e5h

PDB Description: solution structure of rna binding domain in zinc finger cchc-type and rna binding motif 1

PDB Compounds: (A:) Zinc finger CCHC-type and RNA-binding motif-containing protein 1

SCOPe Domain Sequences for d2e5ha1:

Sequence; same for both SEQRES and ATOM records:

>d2e5ha1 d.58.7.0 (A:1-87) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msgglapskstvyvsnlpfsltnndlyrifskygkvvkvtimkdkdtrkskgvafilfld
kdsaqnctrainnkqlfgrvikasiai

Timeline for d2e5ha1:

• d2e5ha1 first appeared in SCOPe 2.04, called d2e5ha_
  
• d2e5ha1 was called d2e5ha_ in SCOPe 2.05
  
• d2e5ha1 appears in SCOPe 2.07
  
• d2e5ha1 appears in the current release, SCOPe 2.08