Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) |
Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
Protein automated matches [226904] (27 species) not a true protein |
Species Geobacillus thermodenitrificans [TaxId:33940] [255126] (1 PDB entry) |
Domain d2dzdb2: 2dzd B:121-339 [241669] Other proteins in same PDB: d2dzda1, d2dzda3, d2dzdb1, d2dzdb3 automated match to d1ulza3 |
PDB Entry: 2dzd (more details), 2.4 Å
SCOPe Domain Sequences for d2dzdb2:
Sequence, based on SEQRES records: (download)
>d2dzdb2 d.142.1.0 (B:121-339) automated matches {Geobacillus thermodenitrificans [TaxId: 33940]} kvkarhaavnagipvipgsdgpvdgledvvafaeahgypiiikaalggggrgmrivrsks evkeaferakseakaafgsdevyveklienpkhievqilgdyegnivhlyerdcsvqrrh qkvvevapsvslsdelrqriceaavqlmrsvgyvnagtveflvsgdefyfievnpriqve htitemitgidivqsqiliadgcslhshevgipkqedir
>d2dzdb2 d.142.1.0 (B:121-339) automated matches {Geobacillus thermodenitrificans [TaxId: 33940]} kvkarhaavnagipvipgsdgpvdgledvvafaeahgypiiikaalggggrgmrivrsks evkeaferakseakevyveklienpkhievqilgdyegnivhlyerdcsvqrrhqkvvev apsvslsdelrqriceaavqlmrsvgyvnagtveflvsgdefyfievnpriqvehtitem itgidivqsqiliadgcslhshevgipkqedir
Timeline for d2dzdb2: