Lineage for d2dzdb2 (2dzd B:121-339)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1928430Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1928431Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) (S)
  5. 1928777Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 1928778Protein automated matches [226904] (27 species)
    not a true protein
  7. 1928823Species Geobacillus thermodenitrificans [TaxId:33940] [255126] (1 PDB entry)
  8. 1928825Domain d2dzdb2: 2dzd B:121-339 [241669]
    Other proteins in same PDB: d2dzda1, d2dzda3, d2dzdb1, d2dzdb3
    automated match to d1ulza3

Details for d2dzdb2

PDB Entry: 2dzd (more details), 2.4 Å

PDB Description: crystal structure of the biotin carboxylase domain of pyruvate carboxylase
PDB Compounds: (B:) pyruvate carboxylase

SCOPe Domain Sequences for d2dzdb2:

Sequence, based on SEQRES records: (download)

>d2dzdb2 d.142.1.0 (B:121-339) automated matches {Geobacillus thermodenitrificans [TaxId: 33940]}
kvkarhaavnagipvipgsdgpvdgledvvafaeahgypiiikaalggggrgmrivrsks
evkeaferakseakaafgsdevyveklienpkhievqilgdyegnivhlyerdcsvqrrh
qkvvevapsvslsdelrqriceaavqlmrsvgyvnagtveflvsgdefyfievnpriqve
htitemitgidivqsqiliadgcslhshevgipkqedir

Sequence, based on observed residues (ATOM records): (download)

>d2dzdb2 d.142.1.0 (B:121-339) automated matches {Geobacillus thermodenitrificans [TaxId: 33940]}
kvkarhaavnagipvipgsdgpvdgledvvafaeahgypiiikaalggggrgmrivrsks
evkeaferakseakevyveklienpkhievqilgdyegnivhlyerdcsvqrrhqkvvev
apsvslsdelrqriceaavqlmrsvgyvnagtveflvsgdefyfievnpriqvehtitem
itgidivqsqiliadgcslhshevgipkqedir

SCOPe Domain Coordinates for d2dzdb2:

Click to download the PDB-style file with coordinates for d2dzdb2.
(The format of our PDB-style files is described here.)

Timeline for d2dzdb2: