SCOPe 2.04: Domain d2dzdb2: 2dzd B:121-339

Lineage for d2dzdb2 (2dzd B:121-339)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (25 species)
   not a true protein

7. Species Geobacillus thermodenitrificans [TaxId:33940] [255126] (1 PDB entry)

8. Domain d2dzdb2: 2dzd B:121-339 [241669]
   Other proteins in same PDB: d2dzda1, d2dzda3, d2dzdb1, d2dzdb3
   automated match to d1ulza3

Details for d2dzdb2

PDB Entry: 2dzd, 2.4 Å

PDB Description: crystal structure of the biotin carboxylase domain of pyruvate carboxylase

PDB Compounds: (B:) pyruvate carboxylase

SCOPe Domain Sequences for d2dzdb2:

Sequence, based on SEQRES records:

>d2dzdb2 d.142.1.0 (B:121-339) automated matches {Geobacillus thermodenitrificans [TaxId: 33940]}
kvkarhaavnagipvipgsdgpvdgledvvafaeahgypiiikaalggggrgmrivrsks
evkeaferakseakaafgsdevyveklienpkhievqilgdyegnivhlyerdcsvqrrh
qkvvevapsvslsdelrqriceaavqlmrsvgyvnagtveflvsgdefyfievnpriqve
htitemitgidivqsqiliadgcslhshevgipkqedir

Sequence, based on observed residues (ATOM records):

>d2dzdb2 d.142.1.0 (B:121-339) automated matches {Geobacillus thermodenitrificans [TaxId: 33940]}
kvkarhaavnagipvipgsdgpvdgledvvafaeahgypiiikaalggggrgmrivrsks
evkeaferakseakevyveklienpkhievqilgdyegnivhlyerdcsvqrrhqkvvev
apsvslsdelrqriceaavqlmrsvgyvnagtveflvsgdefyfievnpriqvehtitem
itgidivqsqiliadgcslhshevgipkqedir

Timeline for d2dzdb2:

• d2dzdb2 is new in SCOPe 2.04-stable
  
• d2dzdb2 appears in SCOPe 2.05
  
• d2dzdb2 appears in the current release, SCOPe 2.08