SCOPe 2.05: Domain d2dyqa_: 2dyq A:

Lineage for d2dyqa_ (2dyq A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186914] (36 PDB entries)

8. Domain d2dyqa_: 2dyq A: [241656]
   automated match to d1wgua_

Details for d2dyqa_

PDB Entry: 2dyq, 3.1 Å

PDB Description: Crystal Structure of the C-terminal Phophotyrosine Interaction Domain of Human APBB3

PDB Compounds: (A:) Amyloid beta A4 precursor protein-binding family B member 3

SCOPe Domain Sequences for d2dyqa_:

Sequence, based on SEQRES records:

>d2dyqa_ b.55.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqkyealymgtlpvtkamgmdvlneaigtltargdrnawvptmlsvsdslmtahpiqaea
steeeplwqcpvrlvtfigvgrdphtfgliadlgrqsfqcaafwcqphagglseavqaac
mvqyqkclva

Sequence, based on observed residues (ATOM records):

>d2dyqa_ b.55.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqkyealymgtlpvtkamgmdvlneaigtltargdrnawvptmlsvsdslmtahpiqeep
lwqcpvrlvtfigvgrdphtfgliadlgrqsfqcaafwcqphagglseavqaacmvqyqk
clva

Timeline for d2dyqa_:

• d2dyqa_ first appeared in SCOPe 2.04
  
• d2dyqa_ appears in SCOPe 2.06
  
• d2dyqa_ appears in the current release, SCOPe 2.08