Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.0: automated matches [191409] (1 protein) not a true family |
Protein automated matches [190561] (4 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [226265] (5 PDB entries) |
Domain d2dx0b_: 2dx0 B: [241654] automated match to d1mila_ complexed with so4 |
PDB Entry: 2dx0 (more details), 2.5 Å
SCOPe Domain Sequences for d2dx0b_:
Sequence, based on SEQRES records: (download)
>d2dx0b_ d.93.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} saekllqeycaetgakdgtflvresetfpndytlsfwrsgrvqhcrirstmengvmkyyl tdnltfnsiyaliqhyreahlrcaefelrltdpvpnp
>d2dx0b_ d.93.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} saekllqeycaetgakdgtflvresetfdytlsfwrsgrvqhcrirstmengvmkyyltd nltfnsiyaliqhyreahlrcaefelrltdpvpnp
Timeline for d2dx0b_: