Lineage for d2dx0a_ (2dx0 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1918721Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1918722Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1919172Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 1919173Protein automated matches [190561] (3 species)
    not a true protein
  7. 1919241Species Mouse (Mus musculus) [TaxId:10090] [226265] (4 PDB entries)
  8. 1919243Domain d2dx0a_: 2dx0 A: [241653]
    automated match to d1mila_
    complexed with so4

Details for d2dx0a_

PDB Entry: 2dx0 (more details), 2.5 Å

PDB Description: Crystal structure of the N-terminal SH2 domain of mouse phospholipase C-gamma 2
PDB Compounds: (A:) Phospholipase C, gamma 2

SCOPe Domain Sequences for d2dx0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dx0a_ d.93.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dtpptelhfgekwfhkkvesrtsaekllqeycaetgakdgtflvresetfpndytlsfwr
sgrvqhcrirstmengvmkyyltdnltfnsiyaliqhyreahlrcaefelrltdpvp

SCOPe Domain Coordinates for d2dx0a_:

Click to download the PDB-style file with coordinates for d2dx0a_.
(The format of our PDB-style files is described here.)

Timeline for d2dx0a_: