Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) bind purine or pterin in topologically similar sites between subunits |
Family d.96.1.0: automated matches [227243] (1 protein) not a true family |
Protein automated matches [227009] (16 species) not a true protein |
Species Pyrococcus horikoshii OT3 [TaxId:70601] [255116] (2 PDB entries) |
Domain d2dttf_: 2dtt F: [241651] automated match to d2obaa_ complexed with h4b |
PDB Entry: 2dtt (more details), 2.2 Å
SCOPe Domain Sequences for d2dttf_:
Sequence, based on SEQRES records: (download)
>d2dttf_ d.96.1.0 (F:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]} mksriivrtsfdaahavkvgdhwedvhghtfflevaiegeikngyvmdflelrkiveeit keldhrnlnnifenpttenialwigerirdklppyvklkrvvlwegkdngvelew
>d2dttf_ d.96.1.0 (F:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]} mksriivrtsfdaahvhghtfflevaiegeikngyvmdflelrkiveeitkeldhrnlnn ifenpttenialwigerirdklppyvklkrvvlwegkdngvelew
Timeline for d2dttf_: