SCOPe 2.08: Domain d2dqrb_: 2dqr B:

Lineage for d2dqrb_ (2dqr B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.7: Replication terminator protein (RTP) [46807] (1 protein)
   automatically mapped to Pfam PF02334

6. Protein Replication terminator protein (RTP) [46808] (1 species)
   contains long helix in the C-terminal extension; forms dimer similar to the LysR-like dimer

7. Species Bacillus subtilis [TaxId:1423] [46809] (7 PDB entries)

8. Domain d2dqrb_: 2dqr B: [241642]
   automated match to d1bm9a_
   mutant

Details for d2dqrb_

PDB Entry: 2dqr, 3.01 Å

PDB Description: crystal structure of the replication terminator protein mutant rtp.e39k.r42q

PDB Compounds: (B:) Replication termination protein

SCOPe Domain Sequences for d2dqrb_:

Sequence, based on SEQRES records:

>d2dqrb_ a.4.5.7 (B:) Replication terminator protein (RTP) {Bacillus subtilis [TaxId: 1423]}
stgflvkqraflklymitmteqerlyglkllkvlqsefkeigfkpnhtevyrslhelldd
gilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrckkliekalsdnf

Sequence, based on observed residues (ATOM records):

>d2dqrb_ a.4.5.7 (B:) Replication terminator protein (RTP) {Bacillus subtilis [TaxId: 1423]}
stgflvkqraflklymitmteqerlyglkllkvlqsefkeigfkpnhtevyrslhelldd
gilkqikvkkegqevvlyqfkdyeaaklykkqlkveldrckkliekalsdnf

Timeline for d2dqrb_:

• d2dqrb_ first appeared in SCOPe 2.04
  
• d2dqrb_ appears in SCOPe 2.07