Lineage for d2dqra_ (2dqr A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2306619Family a.4.5.7: Replication terminator protein (RTP) [46807] (1 protein)
    automatically mapped to Pfam PF02334
  6. 2306620Protein Replication terminator protein (RTP) [46808] (1 species)
    contains long helix in the C-terminal extension; forms dimer similar to the LysR-like dimer
  7. 2306621Species Bacillus subtilis [TaxId:1423] [46809] (7 PDB entries)
  8. 2306634Domain d2dqra_: 2dqr A: [241641]
    automated match to d1bm9a_
    mutant

Details for d2dqra_

PDB Entry: 2dqr (more details), 3.01 Å

PDB Description: crystal structure of the replication terminator protein mutant rtp.e39k.r42q
PDB Compounds: (A:) Replication termination protein

SCOPe Domain Sequences for d2dqra_:

Sequence, based on SEQRES records: (download)

>d2dqra_ a.4.5.7 (A:) Replication terminator protein (RTP) {Bacillus subtilis [TaxId: 1423]}
rsstgflvkqraflklymitmteqerlyglkllkvlqsefkeigfkpnhtevyrslhell
ddgilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrckkliekalsdnf

Sequence, based on observed residues (ATOM records): (download)

>d2dqra_ a.4.5.7 (A:) Replication terminator protein (RTP) {Bacillus subtilis [TaxId: 1423]}
rsstgflvkqraflklymitmteqerlyglkllkvlqsefkeigfkpnhtevyrslhell
ddgilkqievvlyqfkdyeaaklykkqlkveldrckkliekalsdnf

SCOPe Domain Coordinates for d2dqra_:

Click to download the PDB-style file with coordinates for d2dqra_.
(The format of our PDB-style files is described here.)

Timeline for d2dqra_: