Lineage for d2dnza_ (2dnz A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908439Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1908680Protein RNA binding protein 23 [143352] (1 species)
  7. 1908681Species Human (Homo sapiens) [TaxId:9606] [143353] (2 PDB entries)
    Uniprot Q86U06 148-248
  8. 1908682Domain d2dnza_: 2dnz A: [241635]
    automated match to d1x5sa1

Details for d2dnza_

PDB Entry: 2dnz (more details)

PDB Description: solution structure of the second rna binding domain of rna binding motif protein 23
PDB Compounds: (A:) Probable RNA-binding protein 23

SCOPe Domain Sequences for d2dnza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dnza_ d.58.7.1 (A:) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]}
gssgssglyvgslhfnitedmlrgifepfgkidnivlmkdsdtgrskgygfitfsdseca
rraleqlngfelagrpmrvghvterldggsgpssg

SCOPe Domain Coordinates for d2dnza_:

Click to download the PDB-style file with coordinates for d2dnza_.
(The format of our PDB-style files is described here.)

Timeline for d2dnza_: