SCOPe 2.04: Domain d2dnga_: 2dng A:

Lineage for d2dnga_ (2dng A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (7 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [226227] (3 PDB entries)

8. Domain d2dnga_: 2dng A: [241624]
   automated match to d1wf2a_

Details for d2dnga_

PDB Entry: 2dng

PDB Description: solution structure of rna binding domain in eukaryotic translation initiation factor 4h

PDB Compounds: (A:) Eukaryotic translation initiation factor 4H

SCOPe Domain Sequences for d2dnga_:

Sequence; same for both SEQRES and ATOM records:

>d2dnga_ d.58.7.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgkelpteppytayvgnlpfntvqgdidaifkdlsirsvrlvrdkdtdkfkgfcy
vefdevdslkealtydgallgdrslrvdiaegrkqdksgpssg

Timeline for d2dnga_:

• d2dnga_ is new in SCOPe 2.04-stable
  
• d2dnga_ appears in SCOPe 2.05
  
• d2dnga_ appears in the current release, SCOPe 2.08, called d2dnga1