Class b: All beta proteins [48724] (176 folds) |
Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) two constituent families are related by circular permutation |
Family b.7.1.0: automated matches [191388] (1 protein) not a true family |
Protein automated matches [190497] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188711] (19 PDB entries) |
Domain d2dmga_: 2dmg A: [241608] automated match to d1rh8a_ |
PDB Entry: 2dmg (more details)
SCOPe Domain Sequences for d2dmga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dmga_ b.7.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gssgssgsplgqiqltirhssqrnklivvvhacrnliafsedgsdpyvrmyllpdkrrsg rrkthvskktlnpvfdqsfdfsvslpevqrrtldvavknsggflskdkgllgkvlvalas eelakgwtqwydltedsgpssg
Timeline for d2dmga_: