SCOPe 2.04: Domain d2dmga_: 2dmg A:

Lineage for d2dmga_ (2dmg A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families)
   two constituent families are related by circular permutation

5. Family b.7.1.0: automated matches [191388] (1 protein)
   not a true family

6. Protein automated matches [190497] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188711] (19 PDB entries)

8. Domain d2dmga_: 2dmg A: [241608]
   automated match to d1rh8a_

Details for d2dmga_

PDB Entry: 2dmg

PDB Description: solution structure of the third c2 domain of kiaa1228 protein

PDB Compounds: (A:) KIAA1228 protein

SCOPe Domain Sequences for d2dmga_:

Sequence; same for both SEQRES and ATOM records:

>d2dmga_ b.7.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgsplgqiqltirhssqrnklivvvhacrnliafsedgsdpyvrmyllpdkrrsg
rrkthvskktlnpvfdqsfdfsvslpevqrrtldvavknsggflskdkgllgkvlvalas
eelakgwtqwydltedsgpssg

Timeline for d2dmga_:

• d2dmga_ is new in SCOPe 2.04-stable
  
• d2dmga_ appears in SCOPe 2.05
  
• d2dmga_ appears in the current release, SCOPe 2.08, called d2dmga1