Lineage for d2dlya1 (2dly A:8-115)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2206459Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2206460Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2206931Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2206932Protein automated matches [190561] (4 species)
    not a true protein
  7. 2207028Species Mouse (Mus musculus) [TaxId:10090] [226265] (5 PDB entries)
  8. 2207034Domain d2dlya1: 2dly A:8-115 [241601]
    Other proteins in same PDB: d2dlya2, d2dlya3
    automated match to d1csza_

Details for d2dlya1

PDB Entry: 2dly (more details)

PDB Description: Solution structure of the SH2 domain of murine Fyn-related kinase
PDB Compounds: (A:) fyn-related kinase

SCOPe Domain Sequences for d2dlya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dlya1 d.93.1.0 (A:8-115) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aedrslqaepwffgaikradaekqllysenqtgafliresesqkgdfslsvldegvvkhy
rirrldeggffltrrkvfstlnefvnyytttsdglcvklekpclkiqv

SCOPe Domain Coordinates for d2dlya1:

Click to download the PDB-style file with coordinates for d2dlya1.
(The format of our PDB-style files is described here.)

Timeline for d2dlya1: