Lineage for d2dlya_ (2dly A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1661863Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1661864Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1662297Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 1662298Protein automated matches [190561] (3 species)
    not a true protein
  7. 1662359Species Mouse (Mus musculus) [TaxId:10090] [226265] (3 PDB entries)
  8. 1662363Domain d2dlya_: 2dly A: [241601]
    automated match to d1csza_

Details for d2dlya_

PDB Entry: 2dly (more details)

PDB Description: Solution structure of the SH2 domain of murine Fyn-related kinase
PDB Compounds: (A:) fyn-related kinase

SCOPe Domain Sequences for d2dlya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dlya_ d.93.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgaedrslqaepwffgaikradaekqllysenqtgafliresesqkgdfslsvld
egvvkhyrirrldeggffltrrkvfstlnefvnyytttsdglcvklekpclkiqvsgpss
g

SCOPe Domain Coordinates for d2dlya_:

Click to download the PDB-style file with coordinates for d2dlya_.
(The format of our PDB-style files is described here.)

Timeline for d2dlya_: