Lineage for d2dlla_ (2dll A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478534Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1479947Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1479948Protein automated matches [190154] (52 species)
    not a true protein
  7. 1480067Species Human (Homo sapiens) [TaxId:9606] [186924] (10 PDB entries)
  8. 1480087Domain d2dlla_: 2dll A: [241594]
    automated match to d1irfa_

Details for d2dlla_

PDB Entry: 2dll (more details)

PDB Description: Solution structure of the IRF domain of human interferon regulator factors 4
PDB Compounds: (A:) Interferon regulatory factor 4

SCOPe Domain Sequences for d2dlla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dlla_ a.4.5.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgklrqwlidqidsgkypglvweneeksifripwkhagkqdynreedaalfkawa
lfkgkfregidkpdpptwktrlrcalnksndfeelversqldisdpykvyrivpesgpss
g

SCOPe Domain Coordinates for d2dlla_:

Click to download the PDB-style file with coordinates for d2dlla_.
(The format of our PDB-style files is described here.)

Timeline for d2dlla_: