Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (19 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries) |
Domain d2dl9a_: 2dl9 A: [241591] automated match to d1tnma_ |
PDB Entry: 2dl9 (more details)
SCOPe Domain Sequences for d2dl9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dl9a_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gssgssgpfimdaprdlnisegrmaelkcrtppmssvkwllpngtvlshasrhprisvln dgtlnfshvllsdtgvytcmvtnvagnsnasaylnvssgpssg
Timeline for d2dl9a_: