SCOPe 2.08: Domain d2dhja1: 2dhj A:8-119

Lineage for d2dhja1 (2dhj A:8-119)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries)

8. Domain d2dhja1: 2dhj A:8-119 [241568]
   Other proteins in same PDB: d2dhja2, d2dhja3
   automated match to d1wjma_

Details for d2dhja1

PDB Entry: 2dhj

PDB Description: solution structure of the ph domain of rho gtpase activating protein 21 from human

PDB Compounds: (A:) Rho GTPase activating protein 21

SCOPe Domain Sequences for d2dhja1:

Sequence; same for both SEQRES and ATOM records:

>d2dhja1 b.55.1.0 (A:8-119) automated matches {Human (Homo sapiens) [TaxId: 9606]}
daakegwlhfrplvtdkgkrvggsirpwkqmyvvlrghslylykdkreqttpseeeqpis
vnaclidisysetkrknvfrlttsdceclfqaedrddmlawiktiqessnln

Timeline for d2dhja1:

• d2dhja1 first appeared in SCOPe 2.04, called d2dhja_
  
• d2dhja1 appears in SCOPe 2.07