Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
Protein automated matches [190753] (21 species) not a true protein |
Species Pyrococcus horikoshii [TaxId:53953] [255114] (1 PDB entry) |
Domain d2dcla_: 2dcl A: [241551] automated match to d1o51a_ complexed with amp |
PDB Entry: 2dcl (more details), 2.28 Å
SCOPe Domain Sequences for d2dcla_:
Sequence, based on SEQRES records: (download)
>d2dcla_ d.58.5.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 53953]} vevehwntlrlriyigendkwegrplykviveklremgiagatvyrgiygfgkksrvhss dvirlstdlpiivevvdrghniekvvnvikpmikdgmitveptivlwvgtqee
>d2dcla_ d.58.5.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 53953]} vevehwntlrlriyigendkwegrplykviveklremgiagatvyrgiygfgtdlpiive vvdrghniekvvnvikpmikdgmitveptivlwvgtqee
Timeline for d2dcla_: