Lineage for d2dcla_ (2dcl A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950865Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 2950866Protein automated matches [190753] (21 species)
    not a true protein
  7. 2951037Species Pyrococcus horikoshii [TaxId:53953] [255114] (1 PDB entry)
  8. 2951038Domain d2dcla_: 2dcl A: [241551]
    automated match to d1o51a_
    complexed with amp

Details for d2dcla_

PDB Entry: 2dcl (more details), 2.28 Å

PDB Description: structure of ph1503 protein from pyrococcus horikoshii ot3
PDB Compounds: (A:) Hypothetical UPF0166 protein PH1503

SCOPe Domain Sequences for d2dcla_:

Sequence, based on SEQRES records: (download)

>d2dcla_ d.58.5.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
vevehwntlrlriyigendkwegrplykviveklremgiagatvyrgiygfgkksrvhss
dvirlstdlpiivevvdrghniekvvnvikpmikdgmitveptivlwvgtqee

Sequence, based on observed residues (ATOM records): (download)

>d2dcla_ d.58.5.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
vevehwntlrlriyigendkwegrplykviveklremgiagatvyrgiygfgtdlpiive
vvdrghniekvvnvikpmikdgmitveptivlwvgtqee

SCOPe Domain Coordinates for d2dcla_:

Click to download the PDB-style file with coordinates for d2dcla_.
(The format of our PDB-style files is described here.)

Timeline for d2dcla_: