Class b: All beta proteins [48724] (176 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
Protein automated matches [190052] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186914] (32 PDB entries) |
Domain d2d9ya_: 2d9y A: [241529] automated match to d1v89a_ |
PDB Entry: 2d9y (more details)
SCOPe Domain Sequences for d2d9ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d9ya_ b.55.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gssgssgnapvtkagwlfkqassgvkqwnkrwfvlvdrclfyykdekeesilgsipllsf rvaavqpsdnisrkhtfkaehagvrtyffsaespeeqeawiqamgeaarvqsgpssg
Timeline for d2d9ya_: