Lineage for d2d8ka1 (2d8k A:8-135)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2772795Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. 2773072Family b.7.1.0: automated matches [191388] (1 protein)
    not a true family
  6. 2773073Protein automated matches [190497] (4 species)
    not a true protein
  7. 2773076Species Human (Homo sapiens) [TaxId:9606] [188711] (30 PDB entries)
  8. 2773125Domain d2d8ka1: 2d8k A:8-135 [241516]
    Other proteins in same PDB: d2d8ka2, d2d8ka3
    automated match to d1byna_

Details for d2d8ka1

PDB Entry: 2d8k (more details)

PDB Description: solution structure of the first c2 domain of synaptotagmin vii
PDB Compounds: (A:) synaptotagmin VII

SCOPe Domain Sequences for d2d8ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d8ka1 b.7.1.0 (A:8-135) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srenlgriqfsvgynfqestltvkimkaqelpakdfsgtsdpfvkiyllpdkkhkletkv
krknlnphwnetflfegfpyekvvqrilylqvldydrfsrndpigevsiplnkvdltqmq
tfwkdlkp

SCOPe Domain Coordinates for d2d8ka1:

Click to download the PDB-style file with coordinates for d2d8ka1.
(The format of our PDB-style files is described here.)

Timeline for d2d8ka1: