SCOPe 2.04: Domain d2d86a_: 2d86 A:

Lineage for d2d86a_ (2d86 A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.0: automated matches [227151] (1 protein)
   not a true family

6. Protein automated matches [226856] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224978] (24 PDB entries)

8. Domain d2d86a_: 2d86 A: [241510]
   automated match to d1ujoa_

Details for d2d86a_

PDB Entry: 2d86

PDB Description: solution structure of the ch domain from human vav-3 protein

PDB Compounds: (A:) Vav-3 protein

SCOPe Domain Sequences for d2d86a_:

Sequence; same for both SEQRES and ATOM records:

>d2d86a_ a.40.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgmepwkqcaqwlihckvlptnhrvtwdsaqvfdlaqtlrdgvllcqllnnlrah
sinlkeinlrpqmsqflclknirtfltaccetfgmrkselfeafdlfdvrdfgkvietls
rlsrtpialatgirpfpsgpssg

Timeline for d2d86a_:

• d2d86a_ is new in SCOPe 2.04-stable
  
• d2d86a_ appears in SCOPe 2.05
  
• d2d86a_ appears in the current release, SCOPe 2.08, called d2d86a1