SCOPe 2.04: Domain d2ct8b2: 2ct8 B:347-497

Lineage for d2ct8b2 (2ct8 B:347-497)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
   core: 4 helices; bundle; one loop crosses over one side of the bundle

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families)

5. Family a.27.1.0: automated matches [227164] (1 protein)
   not a true family

6. Protein automated matches [226872] (7 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:63363] [230623] (2 PDB entries)

8. Domain d2ct8b2: 2ct8 B:347-497 [241487]
   Other proteins in same PDB: d2ct8a1, d2ct8b1
   automated match to d2csxa2
   protein/RNA complex; complexed with msp

Details for d2ct8b2

PDB Entry: 2ct8, 2.7 Å

PDB Description: Crystal structure of Aquifex aeolicus methionyl-tRNA synthetase complexed with tRNA(Met) and methionyl-adenylate anologue

PDB Compounds: (B:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d2ct8b2:

Sequence; same for both SEQRES and ATOM records:

>d2ct8b2 a.27.1.0 (B:347-497) automated matches {Aquifex aeolicus [TaxId: 63363]}
laneignlysrvvnmahkflggevsgardeeyakiaqesiknyenymekvnfykaieeil
kftsylnkyvdekqpwalnkerkkeelqkvlyalvdglfvlthllypitpnkmkealqml
gekeflkelkpyskntyklgerkilfpkreg

Timeline for d2ct8b2:

• d2ct8b2 is new in SCOPe 2.04-stable
  
• d2ct8b2 appears in SCOPe 2.05
  
• d2ct8b2 appears in the current release, SCOPe 2.08