Lineage for d2cnca1 (2cnc A:34-379)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.3: beta-glycanases [51487] (27 proteins)
consist of a number of sequence families
Protein automated matches [190057] (28 species)
not a true protein
Species Cellvibrio mixtus [TaxId:39650] [255089] (1 PDB entry) 
Domain d2cnca1: 2cnc A:34-379 [241469]
Other proteins in same PDB: d2cnca2
automated match to d1ur1a_
complexed with cl, mg
Details for d2cnca1
PDB Entry: 2cnc (more details), 2.4 Å
PDB Description: family 10 xylanase
PDB Compounds: (A:) endoxylanaseSCOPe Domain Sequences for d2cnca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cnca1 c.1.8.3 (A:34-379) automated matches {Cellvibrio mixtus [TaxId: 39650]}
tglksaykdnfligaalnatiasgaderlntliakefnsitpencmkwgvlrdaqgqwnw
kdadafvafgtkhnlhmvghtlvwhsqihdevfknadgsyiskaalqkkmeehittlagr
ykgklaawdvvneavgddlkmrdshwykimgddfiynaftlanevdpkahlmyndynier
tgkreatvemierlqkrgmpihglgiqghlgidtppiaeieksiiafaklglrvhftsld
vdvlpsvwelpvaevstrfeykperdpytkglpqemqdklakryedlfklfikhsdkidr
vtfwgvsddaswlndfsipgrtnypllfdrklqpkdayfrlldlkr
SCOPe Domain Coordinates for d2cnca1:
Click to download the PDB-style file with coordinates for d2cnca1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2cnca1:
- d2cnca1 first appeared in SCOPe 2.04, called d2cnca_
- d2cnca1 appears in SCOPe 2.07
View in 3D
