Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein automated matches [190057] (28 species) not a true protein |
Species Cellvibrio mixtus [TaxId:39650] [255089] (1 PDB entry) |
Domain d2cnca1: 2cnc A:34-379 [241469] Other proteins in same PDB: d2cnca2 automated match to d1ur1a_ complexed with cl, mg |
PDB Entry: 2cnc (more details), 2.4 Å
SCOPe Domain Sequences for d2cnca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cnca1 c.1.8.3 (A:34-379) automated matches {Cellvibrio mixtus [TaxId: 39650]} tglksaykdnfligaalnatiasgaderlntliakefnsitpencmkwgvlrdaqgqwnw kdadafvafgtkhnlhmvghtlvwhsqihdevfknadgsyiskaalqkkmeehittlagr ykgklaawdvvneavgddlkmrdshwykimgddfiynaftlanevdpkahlmyndynier tgkreatvemierlqkrgmpihglgiqghlgidtppiaeieksiiafaklglrvhftsld vdvlpsvwelpvaevstrfeykperdpytkglpqemqdklakryedlfklfikhsdkidr vtfwgvsddaswlndfsipgrtnypllfdrklqpkdayfrlldlkr
Timeline for d2cnca1: