Lineage for d2ckwa_ (2ckw A:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1951566Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1951567Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1953148Family e.8.1.0: automated matches [227142] (1 protein)
    not a true family
  6. 1953149Protein automated matches [226844] (5 species)
    not a true protein
  7. 1953190Species Sapporo virus [TaxId:95342] [231278] (4 PDB entries)
  8. 1953191Domain d2ckwa_: 2ckw A: [241455]
    automated match to d2uuta_

Details for d2ckwa_

PDB Entry: 2ckw (more details), 2.3 Å

PDB Description: the 2.3 a resolution structure of the sapporo virus rna dependant rna polymerase.
PDB Compounds: (A:) RNA-directed RNA polymerase

SCOPe Domain Sequences for d2ckwa_:

Sequence, based on SEQRES records: (download)

>d2ckwa_ e.8.1.0 (A:) automated matches {Sapporo virus [TaxId: 95342]}
defqwkglpvvksgldvggmptgtryhrspawpeeqpgethapapfgsgdkrytfsqtem
lvnglkpyteptagvppqllsravthvrsyietiigthrspvltyhqacellerttscgp
fvqglkgdywdeeqqqytgvlanhleqawdkankgiaprnayklalkdelrpieknkagk
rrllwgcdaattliataafkavatrlqvvtpmtpvavginmdsvqmqvmndslkggvlyc
ldyskwdstqnpavtaaslailerfaephpivscaiealsspaegyvndikfvtrgglps
gmpftsvvnsinhmiyvaaailqayeshnvpytgnvfqvetihtygddcmysvcpatasi
fhtvlanltsyglkptaadksdaikptntpvflkrtftqtphgirallditsitrqfywl
kanrtsdpssppafdrqarsaqlenalayasqhgpvmfdtvrqiaiktaqgeglvlvntn
ydqalatynawfiggt

Sequence, based on observed residues (ATOM records): (download)

>d2ckwa_ e.8.1.0 (A:) automated matches {Sapporo virus [TaxId: 95342]}
defqwkglpvvksgldvggmptgtryhrspawpeeqpgethapapfgsgdkrytfsqtem
lvnglkpyteptagvppqllsravthvrsyietiigthrspvltyhqacellerttscgp
fvqglkgdywdeeqqqytgvlanhleqawdkankgiaprnayklalkdelrpieknkagk
rrllwgcdaattliataafkavatrlqvvtpmtpvavginmdsvqmqvmndslkggvlyc
ldyskwdstqnpavtaaslailerfaephpivscaiealsspaegyvndikfvtrgglps
gmpftsvvnsinhmiyvaaailqayeshnvpytgnvfqvetihtygddcmysvcpatasi
fhtvlanltsyglkpkptntpvflkrtftqtphgirallditsitrqfywlkanrtsdps
sppafdrqarsaqlenalayasqhgpvmfdtvrqiaiktaqgeglvlvntnydqalatyn
awfiggt

SCOPe Domain Coordinates for d2ckwa_:

Click to download the PDB-style file with coordinates for d2ckwa_.
(The format of our PDB-style files is described here.)

Timeline for d2ckwa_: