SCOPe 2.06: Domain d2c7ja_: 2c7j A:

Lineage for d2c7ja_ (2c7j A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein automated matches [190531] (18 species)
   not a true protein

7. Species Mastigocladus laminosus [TaxId:83541] [187515] (3 PDB entries)

8. Domain d2c7ja_: 2c7j A: [241425]
   automated match to d2j96a_
   complexed with bla, cyc

Details for d2c7ja_

PDB Entry: 2c7j, 3 Å

PDB Description: phycoerythrocyanin from mastigocladus laminosus, 295 k, 3.0 a

PDB Compounds: (A:) phycoerythrocyanin alpha chain

SCOPe Domain Sequences for d2c7ja_:

Sequence; same for both SEQRES and ATOM records:

>d2c7ja_ a.1.1.3 (A:) automated matches {Mastigocladus laminosus [TaxId: 83541]}
mktplteaiaaadlrgsylsntelqavfgrfnraragleaarafanngkkwaeaaanhvy
qkfpyttqmqgpqyastpegkakcvrdidhylrtisyccvvggtgplddyvvaglkefns
alglspswyiaalefvrdnhgltgdvageantyinyainals

Timeline for d2c7ja_:

• d2c7ja_ first appeared in SCOPe 2.04
  
• d2c7ja_ appears in SCOPe 2.05
  
• d2c7ja_ appears in SCOPe 2.07
  
• d2c7ja_ appears in the current release, SCOPe 2.08