Lineage for d2c6qf1 (2c6q F:10-336)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2828761Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2828808Family c.1.5.0: automated matches [227276] (1 protein)
    not a true family
  6. 2828809Protein automated matches [227084] (16 species)
    not a true protein
  7. 2828995Species Human (Homo sapiens) [TaxId:9606] [230557] (5 PDB entries)
  8. 2829001Domain d2c6qf1: 2c6q F:10-336 [241422]
    Other proteins in same PDB: d2c6qa2, d2c6qb2, d2c6qc2, d2c6qd2, d2c6qe2, d2c6qf2, d2c6qg2, d2c6qh2
    automated match to d2bzna_
    complexed with imp, ndp

Details for d2c6qf1

PDB Entry: 2c6q (more details), 1.7 Å

PDB Description: crystal structure of human guanosine monophosphate reductase 2 gmpr2 in complex with imp and nadph
PDB Compounds: (F:) GMP reductase 2

SCOPe Domain Sequences for d2c6qf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c6qf1 c.1.5.0 (F:10-336) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldfkdvllrpkrstlksrsevdltrsfsfrnskqtysgvpiiaanmdtvgtfemakvlck
fslftavhkhyslvqwqefagqnpdclehlaassgtgssdfeqleqileaipqvkyicld
vangysehfvefvkdvrkrfpqhtimagnvvtgemveelilsgadiikvgigpgsvcttr
kktgvgypqlsavmecadaahglkghiisdggcscpgdvakafgagadfvmlggmlaghs
esggelierdgkkyklfygmssemamkkyaggvaeyrasegktvevpfkgdvehtirdil
ggirstctyvgaaklkelsrrttfirv

SCOPe Domain Coordinates for d2c6qf1:

Click to download the PDB-style file with coordinates for d2c6qf1.
(The format of our PDB-style files is described here.)

Timeline for d2c6qf1: