Lineage for d2c6na_ (2c6n A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1660634Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1660635Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1661658Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 1661659Protein automated matches [190805] (12 species)
    not a true protein
  7. 1661678Species Human (Homo sapiens) [TaxId:9606] [188286] (26 PDB entries)
  8. 1661722Domain d2c6na_: 2c6n A: [241415]
    automated match to d4bzsa_
    complexed with act, cl, gol, lpr, nag, ndg, zn

Details for d2c6na_

PDB Entry: 2c6n (more details), 3 Å

PDB Description: structure of human somatic angiontensin-i converting enzyme n domain with lisinopril
PDB Compounds: (A:) Angiotensin-converting enzyme, somatic isoform

SCOPe Domain Sequences for d2c6na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c6na_ d.92.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldpglqpgnfsadeagaqlfaqsynssaeqvlfqsvaaswahdtnitaenarrqeeaall
sqefaeawgqkakelyepiwqnftdpqlrriigavrtlgsanlplakrqqynallsnmsr
iystakvclpnktatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedfta
lsneaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdr
yinlrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwnathmfrvaeef
ftslelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvh
hemghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtes
dinyllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrn
ethfdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagakl
rkvlqagssrpwqevlkdmvgldaldaqpllkyfqpvtqwlqeqnqqngevlgwpeyqwh
pplpdnypegid

SCOPe Domain Coordinates for d2c6na_:

Click to download the PDB-style file with coordinates for d2c6na_.
(The format of our PDB-style files is described here.)

Timeline for d2c6na_: