Lineage for d2c6fb_ (2c6f B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2530179Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2530180Protein automated matches [190805] (17 species)
    not a true protein
  7. 2530208Species Human (Homo sapiens) [TaxId:9606] [188286] (57 PDB entries)
  8. 2530266Domain d2c6fb_: 2c6f B: [241412]
    automated match to d4bzsa_
    complexed with act, cl, gol, nag, zn

Details for d2c6fb_

PDB Entry: 2c6f (more details), 3.01 Å

PDB Description: structure of human somatic angiontensin-i converting enzyme n domain
PDB Compounds: (B:) Angiotensin-converting enzyme, somatic isoform

SCOPe Domain Sequences for d2c6fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c6fb_ d.92.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpglqpgnfsadeagaqlfaqsynssaeqvlfqsvaaswahdtnitaenarrqeeaalls
qefaeawgqkakelyepiwqnftdpqlrriigavrtlgsanlplakrqqynallsnmsri
ystakvclpnktatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedftal
sneaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdry
inlrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwnathmfrvaeeff
tslelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvhh
emghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtesd
inyllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrne
thfdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagaklr
kvlqagssrpwqevlkdmvgldaldaqpllkyfqpvtqwlqeqnqqngevlgwpeyqwhp
plpdnypegid

SCOPe Domain Coordinates for d2c6fb_:

Click to download the PDB-style file with coordinates for d2c6fb_.
(The format of our PDB-style files is described here.)

Timeline for d2c6fb_: