Lineage for d2c2fa_ (2c2f A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2704045Species Deinococcus radiodurans [TaxId:243230] [255080] (2 PDB entries)
  8. 2704047Domain d2c2fa_: 2c2f A: [241405]
    automated match to d3ak8f_
    complexed with fe, gol, so4, zn

Details for d2c2fa_

PDB Entry: 2c2f (more details), 1.61 Å

PDB Description: dps from deinococcus radiodurans
PDB Compounds: (A:) DNA-binding stress response protein

SCOPe Domain Sequences for d2c2fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c2fa_ a.25.1.0 (A:) automated matches {Deinococcus radiodurans [TaxId: 243230]}
ggadhadaahlgtvnnalvnhhyleekefqtvaetlqrnlattislylkfkkyhwdirgr
ffrdlhlaydefiaeifpsideqaerlvalggsplaapadlarystvqvpqetvrdartq
vadlvqdlsrvgkgyrddsqacdeandpvtadmyngyaatidkirwmlqaimdderld

SCOPe Domain Coordinates for d2c2fa_:

Click to download the PDB-style file with coordinates for d2c2fa_.
(The format of our PDB-style files is described here.)

Timeline for d2c2fa_: