SCOPe 2.04: Domain d2c00b3: 2c00 B:331-445

Lineage for d2c00b3 (2c00 B:331-445)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families)

5. Family b.84.2.0: automated matches [254217] (1 protein)
   not a true family

6. Protein automated matches [254496] (10 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [255074] (2 PDB entries)

8. Domain d2c00b3: 2c00 B:331-445 [241402]
   Other proteins in same PDB: d2c00a1, d2c00a2, d2c00b1, d2c00b2
   automated match to d2w70a3
   complexed with so4

Details for d2c00b3

PDB Entry: 2c00, 2.5 Å

PDB Description: crystal structure of biotin carboxylase from pseudomonas aeruginosa in apo form

PDB Compounds: (B:) biotin carboxylase

SCOPe Domain Sequences for d2c00b3:

Sequence; same for both SEQRES and ATOM records:

>d2c00b3 b.84.2.0 (B:331-445) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
rghalecrinaedpktfmpspgkvkhfhapggngvrvdshlysgysvppnydslvgkvit
ygadrdealarmrnaldelivdgiktntelhkdlvrdaafckggvnihylekklg

Timeline for d2c00b3:

• d2c00b3 is new in SCOPe 2.04-stable
  
• d2c00b3 appears in SCOPe 2.05
  
• d2c00b3 appears in the current release, SCOPe 2.08