Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
Protein automated matches [226904] (32 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [255073] (2 PDB entries) |
Domain d2c00b2: 2c00 B:115-330 [241401] Other proteins in same PDB: d2c00a1, d2c00a3, d2c00b1, d2c00b3 automated match to d2w70a2 complexed with so4 |
PDB Entry: 2c00 (more details), 2.5 Å
SCOPe Domain Sequences for d2c00b2:
Sequence, based on SEQRES records: (download)
>d2c00b2 d.142.1.0 (B:115-330) automated matches {Pseudomonas aeruginosa [TaxId: 287]} dkvsakdamkragvptvpgsdgplpedeetalaiarevgypviikaagggggrgmrvvyd eseliksakltrteagaafgnpmvylekfltnprhvevqvlsdgqgnaihlgdrdcslqr rhqkvieeapapgidekarqevfarcvqacieigyrgagtfeflyengrfyfiemntrvq vehpvsemvtgvdivkemlriasgeklsirqedvvi
>d2c00b2 d.142.1.0 (B:115-330) automated matches {Pseudomonas aeruginosa [TaxId: 287]} dkvsakdamkragvptvpgsdgplpedeetalaiarevgypviikaagggmrvvydesel iksakltrteagagnpmvylekfltnprhvevqvlsdgqgnaihlgdrdcslqrrhqkvi eeapapgidekarqevfarcvqacieigyrgagtfeflyengrfyfiemntrvqvehpvs emvtgvdivkemlriasgeklsirqedvvi
Timeline for d2c00b2: