Lineage for d2bzdc3 (2bzd C:506-647)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1530204Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1530205Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1530952Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 1530953Protein automated matches [190770] (24 species)
    not a true protein
  7. Species Micromonospora viridifaciens [TaxId:1881] [254943] (3 PDB entries)
  8. 1531126Domain d2bzdc3: 2bzd C:506-647 [241394]
    Other proteins in same PDB: d2bzda1, d2bzda2, d2bzdb1, d2bzdb2, d2bzdc1, d2bzdc2
    automated match to d1w8oa2
    complexed with gal, gol, na

Details for d2bzdc3

PDB Entry: 2bzd (more details), 2 Å

PDB Description: galactose recognition by the carbohydrate-binding module of a bacterial sialidase.
PDB Compounds: (C:) bacterial sialidase

SCOPe Domain Sequences for d2bzdc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bzdc3 b.18.1.0 (C:506-647) automated matches {Micromonospora viridifaciens [TaxId: 1881]}
qarmsiadvdseetaredgrasnvidgnpstfwhtewsradapgyphrisldlggthtis
glqytrrqnsaneqvadyeiytslngttwdgpvasgrfttslapqravfpardaryirlv
alseqtghkyaavaelevegqr

SCOPe Domain Coordinates for d2bzdc3:

Click to download the PDB-style file with coordinates for d2bzdc3.
(The format of our PDB-style files is described here.)

Timeline for d2bzdc3: