Class b: All beta proteins [48724] (176 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (24 species) not a true protein |
Domain d2bzdc3: 2bzd C:506-647 [241394] Other proteins in same PDB: d2bzda1, d2bzda2, d2bzdb1, d2bzdb2, d2bzdc1, d2bzdc2 automated match to d1w8oa2 complexed with gal, gol, na |
PDB Entry: 2bzd (more details), 2 Å
SCOPe Domain Sequences for d2bzdc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bzdc3 b.18.1.0 (C:506-647) automated matches {Micromonospora viridifaciens [TaxId: 1881]} qarmsiadvdseetaredgrasnvidgnpstfwhtewsradapgyphrisldlggthtis glqytrrqnsaneqvadyeiytslngttwdgpvasgrfttslapqravfpardaryirlv alseqtghkyaavaelevegqr
Timeline for d2bzdc3: