Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) |
Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (8 proteins) |
Protein automated matches [254445] (3 species) not a true protein |
Species Arthrobacter nicotinovorans [TaxId:29320] [255063] (1 PDB entry) |
Domain d2bvgd1: 2bvg D:5-205 [241349] Other proteins in same PDB: d2bvga2, d2bvgb2, d2bvgc2, d2bvgd2 automated match to d2bvha2 complexed with fad |
PDB Entry: 2bvg (more details), 3.18 Å
SCOPe Domain Sequences for d2bvgd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bvgd1 d.145.1.1 (D:5-205) automated matches {Arthrobacter nicotinovorans [TaxId: 29320]} klatplsiqgeviypddsgfdaianiwdgrhlqrpsliarclsagdvaksvryacdngle isvrsgghnpngyatndggivldlrlmnsihidtagsrarigggvisgdlvkeaakfgla avtgmhpkvgfcglalnggvgfltpkyglasdnilgatlvtatgdviycsdderpelfwa vrgagpnfgvvtevevqlyel
Timeline for d2bvgd1: