SCOPe 2.07: Domain d2b7lc_: 2b7l C:

Lineage for d2b7lc_ (2b7l C:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.2: Cytidylyltransferase [52394] (2 proteins)
   automatically mapped to Pfam PF01467

6. Protein automated matches [254481] (1 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [255045] (1 PDB entry)

8. Domain d2b7lc_: 2b7l C: [241275]
   automated match to d1coza_

Details for d2b7lc_

PDB Entry: 2b7l, 3 Å

PDB Description: Crystal Structure of CTP:Glycerol-3-Phosphate Cytidylyltransferase from Staphylococcus aureus

PDB Compounds: (C:) glycerol-3-phosphate cytidylyltransferase

SCOPe Domain Sequences for d2b7lc_:

Sequence; same for both SEQRES and ATOM records:

>d2b7lc_ c.26.1.2 (C:) automated matches {Staphylococcus aureus [TaxId: 1280]}
mkrvitygtydllhyghiellrraremgdylivalstdefnqikhkksyydyeqrkmmle
siryvdlvipekgwgqkeddvekfdvdvfvmghdwegefdflkdkceviylkr

Timeline for d2b7lc_:

• d2b7lc_ first appeared in SCOPe 2.04
  
• d2b7lc_ appears in SCOPe 2.06
  
• d2b7lc_ appears in the current release, SCOPe 2.08