SCOPe 2.08: Domain d2ahlb_: 2ahl B:

Lineage for d2ahlb_ (2ahl B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.386: Tyrosinase cofactor MelC1-like [254118] (1 superfamily)
   2 layers: a/b; antiparallel beta-sheet of 6 strands partly surrounding one helix. Fold-level similarity and potential homology to SH2 domains (d.93) noted in PubMed 16436386

4. Superfamily d.386.1: Tyrosinase cofactor MelC1 [254141] (2 families)
   Pfam PF06236

5. Family d.386.1.1: Tyrosinase cofactor MelC1 [254186] (2 proteins)

6. Protein Tyrosinase cofactor MelC1 [254410] (1 species)

7. Species Streptomyces castaneoglobisporus [TaxId:79261] [254849] (33 PDB entries)

8. Domain d2ahlb_: 2ahl B: [241233]
   Other proteins in same PDB: d2ahla1, d2ahla2
   automated match to d2ahkb_
   complexed with cu1, no3

Details for d2ahlb_

PDB Entry: 2ahl, 1.6 Å

PDB Description: Crystal structure of the hydroxylamine-induced deoxy-form of the copper-bound Streptomyces castaneoglobisporus tyrosinase in complex with a caddie protein

PDB Compounds: (B:) caddie protein orf378

SCOPe Domain Sequences for d2ahlb_:

Sequence, based on SEQRES records:

>d2ahlb_ d.386.1.1 (B:) Tyrosinase cofactor MelC1 {Streptomyces castaneoglobisporus [TaxId: 79261]}
aapesfdevykgrriqgrpargaahhhehgggyevfvdgvqlhvmrnadgswisvvshyd
pvptpraaaraavdelqgapll

Sequence, based on observed residues (ATOM records):

>d2ahlb_ d.386.1.1 (B:) Tyrosinase cofactor MelC1 {Streptomyces castaneoglobisporus [TaxId: 79261]}
aapesfdevykgrriqgrpagyevfvdgvqlhvmrnadgswisvvshydpvptpraaara
avdelqgapll

Timeline for d2ahlb_:

• d2ahlb_ first appeared in SCOPe 2.04
  
• d2ahlb_ appears in SCOPe 2.07