SCOPe 2.04: Domain d1zwoa1: 1zwo A:1-90

Lineage for d1zwoa1 (1zwo A:1-90)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families)

5. Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)

6. Protein gamma-Crystallin [49697] (8 species)
   duplication consists of two domains of this fold

7. Species Mouse (Mus musculus) [TaxId:10090] [255018] (3 PDB entries)

8. Domain d1zwoa1: 1zwo A:1-90 [241173]
   automated match to d1amma1

Details for d1zwoa1

PDB Entry: 1zwo

PDB Description: nmr structure of murine gamma-s crystallin

PDB Compounds: (A:) gamma crystallin s

SCOPe Domain Sequences for d1zwoa1:

Sequence; same for both SEQRES and ATOM records:

>d1zwoa1 b.11.1.1 (A:1-90) gamma-Crystallin {Mouse (Mus musculus) [TaxId: 10090]}
sktggkisfyedrnfqgrrydcdcdcadfrsylsrcnsirveggtwavyerpnfsghmyi
lpqgeypeyqrwmglndrlgscravhlssg

Timeline for d1zwoa1:

• d1zwoa1 is new in SCOPe 2.04-stable
  
• d1zwoa1 appears in SCOPe 2.05
  
• d1zwoa1 appears in the current release, SCOPe 2.08