Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
Protein automated matches [190087] (15 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [233748] (6 PDB entries) |
Domain d1zmxd_: 1zmx D: [241152] automated match to d2vp4d_ complexed with so4, thm; mutant |
PDB Entry: 1zmx (more details), 3.1 Å
SCOPe Domain Sequences for d1zmxd_:
Sequence, based on SEQRES records: (download)
>d1zmxd_ c.37.1.1 (D:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvdllelmyk dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl ihqrrpqsckvlvldad
>d1zmxd_ c.37.1.1 (D:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvdllelmyk dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt leewykfieesihvqadliiylrtspevayerirqrvplkylqelhelhedwlihqckvl vldad
Timeline for d1zmxd_: