SCOPe 2.04: Domain d1zlpb_: 1zlp B:

Lineage for d1zlpb_ (1zlp B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families)

5. Family c.1.12.0: automated matches [191427] (1 protein)
   not a true family

6. Protein automated matches [190614] (10 species)
   not a true protein

7. Species Clove pink (Dianthus caryophyllus) [TaxId:3570] [255010] (1 PDB entry)

8. Domain d1zlpb_: 1zlp B: [241144]
   automated match to d1pymb_
   complexed with gaq, mg

Details for d1zlpb_

PDB Entry: 1zlp, 2.7 Å

PDB Description: Petal death protein PSR132 with cysteine-linked glutaraldehyde forming a thiohemiacetal adduct

PDB Compounds: (B:) petal death protein

SCOPe Domain Sequences for d1zlpb_:

Sequence; same for both SEQRES and ATOM records:

>d1zlpb_ c.1.12.0 (B:) automated matches {Clove pink (Dianthus caryophyllus) [TaxId: 3570]}
kttmhrlieehgsvlmpgvqdalsaavvektgfhaafvsgysvsaamlglpdfgllttte
vveatrritaaapnlcvvvdgdtggggplnvqrfirelisagakgvfledqvwpkkcghm
rgkavvpaeehalkiaaareaigdsdfflvartdaraphgleegirranlykeagadatf
veapanvdelkevsaktkglrianmieggktplhtpeefkemgfhliahsltavyatara
lvnimkilkekgttrddldqmatfsefnelisleswyemeskfkn

Timeline for d1zlpb_:

• d1zlpb_ is new in SCOPe 2.04-stable
  
• d1zlpb_ appears in SCOPe 2.05
  
• d1zlpb_ appears in the current release, SCOPe 2.08