Lineage for d1zita_ (1zit A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1837703Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1838070Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 1838071Protein automated matches [190131] (59 species)
    not a true protein
  7. 1838072Species Aquifex aeolicus [TaxId:224324] [255008] (2 PDB entries)
  8. 1838075Domain d1zita_: 1zit A: [241139]
    automated match to d1j56a_

Details for d1zita_

PDB Entry: 1zit (more details)

PDB Description: Structure of the receiver domain of NtrC4 from Aquifex aeolicus
PDB Compounds: (A:) transcriptional regulator (NtrC family)

SCOPe Domain Sequences for d1zita_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zita_ c.23.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]}
mkrvlvvddeesitsslsaileeegyhpdtaktlreaekkikelffpvivldvwmpdgdg
vnfidfikenspdsvvivitghgsvdtavkaikkgayeflekpfsverflltikhafeey
s

SCOPe Domain Coordinates for d1zita_:

Click to download the PDB-style file with coordinates for d1zita_.
(The format of our PDB-style files is described here.)

Timeline for d1zita_: