Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (59 species) not a true protein |
Species Aquifex aeolicus [TaxId:224324] [255008] (2 PDB entries) |
Domain d1zita_: 1zit A: [241139] automated match to d1j56a_ |
PDB Entry: 1zit (more details)
SCOPe Domain Sequences for d1zita_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zita_ c.23.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]} mkrvlvvddeesitsslsaileeegyhpdtaktlreaekkikelffpvivldvwmpdgdg vnfidfikenspdsvvivitghgsvdtavkaikkgayeflekpfsverflltikhafeey s
Timeline for d1zita_: