SCOPe 2.08: Domain d1z5xe_: 1z5x E:

Lineage for d1z5xe_ (1z5x E:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein automated matches [190059] (14 species)
   not a true protein

7. Species Bemisia tabaci [TaxId:7038] [255003] (1 PDB entry)

8. Domain d1z5xe_: 1z5x E: [241120]
   automated match to d3ixpd_
   complexed with p1a, po4

Details for d1z5xe_

PDB Entry: 1z5x, 3.07 Å

PDB Description: hemipteran ecdysone receptor ligand-binding domain complexed with ponasterone a

PDB Compounds: (E:) Ecdysone receptor ligand binding domain

SCOPe Domain Sequences for d1z5xe_:

Sequence; same for both SEQRES and ATOM records:

>d1z5xe_ a.123.1.1 (E:) automated matches {Bemisia tabaci [TaxId: 7038]}
pitpeqeelihrlvyfqneyehpspedikrivnaapeeenvaeerfrhiteitiltvqli
vefskrlpgfdkliredqiallkacssevmmfrmarrydaetdsilfatnqpytresytv
agmgdtvedllrfcrhmcamkvdnaeyalltaivifserpslsegwkvekiqeiyiealk
ayvenrrkpyattifakllsvltelrtlgnmnsetcfslklknrkvpsfleeiwdvv

Timeline for d1z5xe_:

• d1z5xe_ first appeared in SCOPe 2.04
  
• d1z5xe_ appears in SCOPe 2.07