SCOPe 2.04: Domain d1z3ra_: 1z3r A:

Lineage for d1z3ra_ (1z3r A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (39 species)
   not a true protein

7. Species Omsk hemorrhagic fever virus [TaxId:12542] [254999] (1 PDB entry)

8. Domain d1z3ra_: 1z3r A: [241108]
   automated match to d1pjwa_

Details for d1z3ra_

PDB Entry: 1z3r

PDB Description: solution structure of the omsk hemhorraghic fever envelope protein domain iii

PDB Compounds: (A:) Polyprotein

SCOPe Domain Sequences for d1z3ra_:

Sequence; same for both SEQRES and ATOM records:

>d1z3ra_ b.1.18.0 (A:) automated matches {Omsk hemorrhagic fever virus [TaxId: 12542]}
iskgltytmcdkakftwkraptdsghdtvvmevafsgtkpcripvravahgapdvdvaml
itpnptmenngggfiemqlppgdniiyvgelkhqwfqkg

Timeline for d1z3ra_:

• d1z3ra_ is new in SCOPe 2.04-stable
  
• d1z3ra_ appears in SCOPe 2.05
  
• d1z3ra_ appears in the current release, SCOPe 2.08, called d1z3ra1