Lineage for d1yyhb_ (1yyh B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006504Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 3006505Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 3006506Family d.211.1.1: Ankyrin repeat [48404] (21 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 3006604Protein automated matches [190101] (7 species)
    not a true protein
  7. 3006626Species Human (Homo sapiens) [TaxId:9606] [187689] (13 PDB entries)
  8. 3006636Domain d1yyhb_: 1yyh B: [241087]
    Other proteins in same PDB: d1yyha2
    automated match to d2f8ya_
    applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d1yyhb_

PDB Entry: 1yyh (more details), 1.9 Å

PDB Description: crystal structure of the human notch 1 ankyrin domain
PDB Compounds: (B:) Notch 1, ankyrin domain

SCOPe Domain Sequences for d1yyhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yyhb_ d.211.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtgetalhlaarysrsdaakrlleasadaniqdnmgrtplhaavsadaqgvfqilirnra
tdldarmhdgttplilaarlavegmledlinshadvnavddlgksalhwaaavnnvdaav
vllkngankdmqnnreetplflaaregsyetakvlldhfanrditdhmdrlprdiaqerm
hhdivrlld

SCOPe Domain Coordinates for d1yyhb_:

Click to download the PDB-style file with coordinates for d1yyhb_.
(The format of our PDB-style files is described here.)

Timeline for d1yyhb_: